Rabbit Polyclonal Anti-KIF2B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KIF2B antibody: synthetic peptide directed towards the middle region of human KIF2B. Synthetic peptide located within the following region: CVCVRKRPLNQRETTLKDLDIITVPSDNVVMVHESKQKVDLTRYLQNQTF |
Rabbit Polyclonal Anti-KIF2B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KIF2B antibody: synthetic peptide directed towards the middle region of human KIF2B. Synthetic peptide located within the following region: DCSKGIYALVAQDVFLLLRNSTYEKLDLKVYGTFFEIYGGKVYDLLNWKK |
KIF2B Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 544-673 of human KIF2B (NP_115948.4). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China