Germany
Japan
United Kingdom
China
Cytokeratin 16 (KRT16) guinea pig polyclonal antibody, Serum
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Immunogen | Synthetic peptide of Human keratin K16 (formerly also designated cytokeratin 16; C-KE QSS SSF SQG QSS), coupled to KLH |
Antibodies
View as table DownloadRabbit Polyclonal Anti-Keratin 16 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Keratin 16 Antibody: A synthesized peptide derived from human Keratin 16 |
Rabbit Polyclonal Anti-KRT16 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KRT16 antibody: synthetic peptide directed towards the middle region of human KRT16. Synthetic peptide located within the following region: IAATIENAQPILQIDNARLAADDFRTKYEHELALRQTVEADVNGLRRVLD |
Rabbit Polyclonal Anti-KRT16 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KRT16 antibody: synthetic peptide directed towards the middle region of human KRT16. Synthetic peptide located within the following region: LRKNHEEEMLALRGQTGGDVNVEMDAAPGVDLSRILNEMRDQYEQMAEKN |
Rabbit Polyclonal Anti-Keratin 16 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Keratin 16 Antibody: A synthesized peptide derived from human Keratin 16 |
Mouse monoclonal Anti-Keratin16 Clone LL025
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) KRT16 mouse monoclonal antibody, clone OTI1A9 (formerly 1A9)
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) KRT16 mouse monoclonal antibody, clone OTI2H8 (formerly 2H8)
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) KRT16 mouse monoclonal antibody, clone OTI2F10 (formerly 2F10)
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
Anti-KRT16 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 195-212 amino acids of Human Keratin, type I cytoskeletal 16 |
Cytokeratin 16 (KRT16) Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 190-430 of human Cytokeratin 16 (KRT16) (NP_005548.2). |
| Modifications | Unmodified |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
KRT16 mouse monoclonal antibody, clone OTI1A9 (formerly 1A9)
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
KRT16 mouse monoclonal antibody, clone OTI1A9 (formerly 1A9), Biotinylated
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
KRT16 mouse monoclonal antibody, clone OTI1A9 (formerly 1A9), HRP conjugated
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | HRP |
KRT16 mouse monoclonal antibody, clone OTI1A9 (formerly 1A9)
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
KRT16 mouse monoclonal antibody, clone OTI2F10 (formerly 2F10)
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
KRT16 mouse monoclonal antibody, clone OTI2F10 (formerly 2F10), Biotinylated
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
KRT16 mouse monoclonal antibody, clone OTI2F10 (formerly 2F10), HRP conjugated
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | HRP |
Active filters
Target Symbol
- KRT16