Rabbit Polyclonal Anti-KRT17 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KRT17 antibody: synthetic peptide directed towards the C terminal of human KRT17. Synthetic peptide located within the following region: IATYRRLLEGEDAHLTQYKKEPVTTRQVRTIVEEVQDGKVISSREQVHQT |
USD 480.00
2 Weeks
KRT17 Rabbit Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human KRT17 |
Rabbit Polyclonal Anti-Keratin 17 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Keratin 17 Antibody: A synthesized peptide derived from human Keratin 17 |
Rabbit Polyclonal Anti-Keratin 17 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Keratin 17 Antibody: A synthesized peptide derived from human Keratin 17 |
Anti-KRT17 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 102-346 amino acids of Human Keratin, type I cytoskeletal 17 |
Mouse Monoclonal Cytokeratin 17 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
KRT17 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human KRT17 |
Cytokeratin 17 (KRT17) Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 133-432 of human Cytokeratin 17 (Cytokeratin 17 (KRT17)) (NP_000413.1). |
| Modifications | Unmodified |
USD 380.00
4 Weeks
Germany
Japan
United Kingdom
China
