Rabbit Polyclonal Anti-L3MBTL3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-L3MBTL3 antibody: synthetic peptide directed towards the N terminal of human L3MBTL3. Synthetic peptide located within the following region: MTESASSTSGQEFDVFSVMDWKDGVGTLPGSDLKFRVNEFGALEVITDEN |
Carrier-free (BSA/glycerol-free) L3MBTL3 mouse monoclonal antibody,clone OTI1B5
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
L3MBTL3 Rabbit polyclonal Antibody
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-230 of human L3MBTL3 (NP_001007103.1). |
| Modifications | Unmodified |
L3MBTL3 mouse monoclonal antibody,clone OTI1B5
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
L3MBTL3 mouse monoclonal antibody,clone OTI1B5, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
L3MBTL3 mouse monoclonal antibody,clone OTI1B5, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
L3MBTL3 mouse monoclonal antibody,clone OTI1B5
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
L3MBTL3 mouse monoclonal antibody,clone OTI1H2
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: "KO15".
USD 420.00
4 Weeks
Germany
Japan
United Kingdom
China
