L3MBTL3 Rabbit Polyclonal Antibody

CAT#: TA339772

Rabbit Polyclonal Anti-L3MBTL3 Antibody

Product Images

WB Suggested Anti-L3MBTL3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: PANC1 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-L3MBTL3 antibody: synthetic peptide directed towards the N terminal of human L3MBTL3. Synthetic peptide located within the following region: MTESASSTSGQEFDVFSVMDWKDGVGTLPGSDLKFRVNEFGALEVITDEN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 86 kDa
• Gene Name: l(3)mbt-like 3 (Drosophila)
• Database Link:
  NP_001007103
  Entrez Gene 84456 Human
  UniProt ID Q96JM7
• Background: L3MBTL3 is a putative Polycomb group (PcG) protein. PcG proteins maintain the transcriptionally repressive state of genes, probably via a modification of chromatin, rendering it heritably changed in its expressibility.L3MBTL3 is required for normal maturation of myeloid progenitor cells.
• Synonyms: MBT-1; MBT1
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Horse: 93%