Rabbit Polyclonal Anti-LARP7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LARP7 antibody: synthetic peptide directed towards the C terminal of human LARP7. Synthetic peptide located within the following region: WQKILVDRQAKLNQPREKKRGTEKLITKAEKIRLAKTQQASKHIRFSEYD |
Rabbit Polyclonal Anti-LARP7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LARP7 antibody: synthetic peptide directed towards the C terminal of human LARP7. Synthetic peptide located within the following region: HCWKLEILSGDHEQRYWQKILVDRQAKLNQPREKKRGTEKLITKAEKIRL |
LARP7 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 526-556 amino acids from the C-terminal region of Human LARP7. |
LARP7 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 160-380 of human LARP7 (NP_057732.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
