LARP7 Rabbit Polyclonal Antibody

CAT#: TA343848

Rabbit Polyclonal Anti-LARP7 Antibody

Product Images

WB Suggested Anti-LARP7 Antibody Titration: 0.2-1 ug/ml; Positive Control: Hela cell lysate

• 

  Host: Rabbit; Target Name: LARP7; Sample Tissue: Hela Whole cell; Lane A: Primary Antibody; Lane B: Primary Antibody + Blocking Peptide; Primary Antibody Concentration: 1 ug/ml; Peptide Concentration: 5 ug/ml; Lysate Quantity: 25 ug/lane; Gel Concentratio

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-LARP7 antibody: synthetic peptide directed towards the C terminal of human LARP7. Synthetic peptide located within the following region: WQKILVDRQAKLNQPREKKRGTEKLITKAEKIRLAKTQQASKHIRFSEYD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 67 kDa
• Gene Name: La ribonucleoprotein domain family member 7
• Database Link:
  NP_056269
  Entrez Gene 51574 Human
  UniProt ID Q4G0J3
• Background: The function remains unknown.
• Synonyms: ALAZS; HDCMA18P; PIP7S
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%