LARP7 Rabbit Polyclonal Antibody

CAT#: TA343849

Rabbit Polyclonal Anti-LARP7 Antibody

Product Images

WB Suggested Anti-LARP7 Antibody Titration: 1.25 ug/ml; Positive Control: Jurkat cell lysateLARP7 is supported by BioGPS gene expression data to be expressed in Jurkat

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-LARP7 antibody: synthetic peptide directed towards the C terminal of human LARP7. Synthetic peptide located within the following region: HCWKLEILSGDHEQRYWQKILVDRQAKLNQPREKKRGTEKLITKAEKIRL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 39 kDa
• Gene Name: La ribonucleoprotein domain family member 7
• Database Link:
  NP_001253968
  Entrez Gene 51574 Human
  UniProt ID Q4G0J3
• Background: The function remains unknown.
• Synonyms: ALAZS; HDCMA18P; PIP7S
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 93%