Rabbit Polyclonal Anti-LHX5 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-LHX5 Antibody: synthetic peptide directed towards the middle region of human LHX5. Synthetic peptide located within the following region: FFRSPRRMRPLGGRLDESEMLGSTPYTYYGDYQGDYYAPGSNYDFFAHGP |
Rabbit Polyclonal Anti-Lhx5 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Lhx5 antibody: synthetic peptide directed towards the middle region of mouse Lhx5. Synthetic peptide located within the following region: FFRSPRRMRPLGGRLDESEMLGSTPYTYYGDYQSDYYAPGGNYDFFAHGP |
LHX5 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 120-180 of human LHX5 (NP_071758.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
