LHX5 Rabbit Polyclonal Antibody

CAT#: TA331774

Rabbit Polyclonal Anti-LHX5 Antibody

Product Images

WB Suggested Anti-LHX5 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: COLO205 cell lysateLHX5 is supported by BioGPS gene expression data to be expressed in COLO205

• 

  Sample Type. Embryonic mouse spinal cord Primary Antibody Dilution: 1: 500; Secondary Antibody: Anti-rabbit-Cy3; Secondary Antibody: ilution. 1: 1000; Color/Signal Descriptions. Red: Lhx5 Cyan: Nissl (Neurons); Gene Name: LHX5; Submitted by: Joshua R. S

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: IHC, WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-LHX5 Antibody: synthetic peptide directed towards the middle region of human LHX5. Synthetic peptide located within the following region: FFRSPRRMRPLGGRLDESEMLGSTPYTYYGDYQGDYYAPGSNYDFFAHGP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 44 kDa
• Gene Name: LIM homeobox 5
• Database Link:
  NP_071758
  Entrez Gene 16873 MouseEntrez Gene 64211 Human
  UniProt ID Q9H2C1
• Background: LHX5 plays an essential role in the regulation of neuronal differentiation and migration during development of the central nervous system.This gene encodes a protein belonging to a large protein family, members of which carry the LIM domain, a unique cysteine-rich zinc-binding domain. The encoded protein may function as a transcriptional regulator and be involved in the control of differentiation and development of the forebrain. In mice, this protein is essential for the regulation of precursor cell proliferation and the control of neuronal differentiation and migration during hippocampal development. This protein is involved in learning and motor functions in adult mice.
• Synonyms: MGC129689
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Mouse: 93%; Zebrafish: 83%

Reference Data

• Protein Families: Druggable Genome