LHX5 Rabbit Polyclonal Antibody

CAT#: TA341788

Rabbit Polyclonal Anti-Lhx5 Antibody

Product Images

WB Suggested Anti-Lhx5 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Mouse Heart

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Lhx5 antibody: synthetic peptide directed towards the middle region of mouse Lhx5. Synthetic peptide located within the following region: FFRSPRRMRPLGGRLDESEMLGSTPYTYYGDYQSDYYAPGGNYDFFAHGP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 44 kDa
• Gene Name: LIM homeobox 5
• Database Link:
  NP_071758
  Entrez Gene 16873 Mouse
  UniProt ID Q9H2C1
• Background: Plays an essential role inThe regulation of neuronal differentiation and migration during development ofThe central nervous system.
• Synonyms: MGC129689
• Note: Immunogen Sequence Homology: Rat: 100%; Mouse: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Human: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Zebrafish: 75%

Reference Data

• Protein Families: Druggable Genome