Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-LZTS1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LZTS1 antibody: synthetic peptide directed towards the C terminal of human LZTS1. Synthetic peptide located within the following region: QQSYVAMYQRNQRLEKALQQLARGDSAGEPLEVDLEGADIPYEDIIATEI |
Rabbit polyclonal LZTS1 Antibody (N-term)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This LZTS1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 77-105 amino acids from the N-terminal region of human LZTS1. |
Rabbit Polyclonal Anti-LZTS1 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human LZTS1 |
Lzts1 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
LZTS1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human LZTS1 |
LZTS1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 337-596 of human LZTS1 (NP_066300.1). |
| Modifications | Unmodified |
USD 420.00
4 Weeks
Active filters
Target Symbol
- LZTS1