LZTS1 Rabbit Polyclonal Antibody

CAT#: TA345318

Rabbit Polyclonal Anti-LZTS1 Antibody

Product Images

WB Suggested Anti-LZTS1 Antibody Titration: 2.5 ug/ml; ELISA Titer: 1: 1562500; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-LZTS1 antibody: synthetic peptide directed towards the C terminal of human LZTS1. Synthetic peptide located within the following region: QQSYVAMYQRNQRLEKALQQLARGDSAGEPLEVDLEGADIPYEDIIATEI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 67 kDa
• Gene Name: leucine zipper, putative tumor suppressor 1
• Database Link:
  NP_066300
  Entrez Gene 11178 Human
  UniProt ID Q9Y250
• Background: LZTS1 involved in the regulation of cell growth. LZTS1 may stabilize the active CDC2-cyclin B1 complex and thereby contribute to the regulation of the cell cycle and the prevention of uncontrolled cell proliferation. LZTS1 may act as tumor suppressor and defects in LZTS1 are found in many types of tumors.
• Synonyms: F37; FEZ1
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Dog: 93%; Rabbit: 93%

Reference Data

• Protein Families: Druggable Genome