Rabbit Polyclonal Anti-LEFTY2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LEFTY2 antibody: synthetic peptide directed towards the N terminal of human LEFTY2. Synthetic peptide located within the following region: MWPLWLCWALWVLPLAGPGAALTEEQLLGSLLRQLQLSEVPVLDRADMEK |
Rabbit Polyclonal Anti-LEFTY2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-LEFTY2 antibody is: synthetic peptide directed towards the N-terminal region of Human LEFTY2. Synthetic peptide located within the following region: AGPGAALTEEQLLGSLLRQLQLSEVPVLDRADMEKLVIPAHVRAQYVVLL |
Mouse monoclonal LEFTY A antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-LEFTY2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
LEFTY2 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human LEFTY2 |
LEFTY2 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
LEFTY2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 57-366 of human LEFTY2 (NP_003231.2). |
| Modifications | Unmodified |
LEFTY2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 57-366 of human LEFTY2 (NP_003231.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
