Antibodies

View as table Download

Rabbit polyclonal antibody to LHR (luteinizing hormone/choriogonadotropin receptor)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 622 and 699 of LHR (Uniprot ID#P22888)

Rabbit Polyclonal Anti-LHCGR Antibody (C-Terminus)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen LHCGR / LHR / LH Receptor antibody was raised against synthetic 19 amino acid peptide from C-terminus of human hCG receptor. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey, Marmoset, Rat, Dog, Panda (95%); Bovine, Bat, Rabbit, Horse (89%); Ferret (84%).

Rabbit Polyclonal Anti-LH Receptor (extracellular)

Applications IF, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Peptide ENELSGWDYDYGFC, corresponding to amino acid residues 327-340 of rat LH receptor. Extracellular, N-terminus.

Rabbit polyclonal anti-LSHR antibody

Applications IF
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human LSHR.

Rabbit Polyclonal Anti-LHCGR Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LHCGR antibody is: synthetic peptide directed towards the C-terminal region of Human LHCGR. Synthetic peptide located within the following region: LLLSKFGCCKRRAELYRRKDFSAYTSNCKNGFTGSNKPSQSTLKLSTLHC

LHCGR rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human LHCGR

LHCGR Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 200-360 of human LHCGR (NP_000224.2).
Modifications Unmodified