Germany
Japan
United Kingdom
China
Antibodies
View as table Download
MAGE 1 (MAGEA1) mouse monoclonal antibody, clone MA454, Purified
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Canine, Human, Rat |
Rabbit Polyclonal Anti-MAGE-1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAGE-1 Antibody: A synthesized peptide derived from human MAGE-1 |
Rabbit Polyclonal Anti-MAGEA1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAGEA1 antibody: synthetic peptide directed towards the N terminal of human MAGEA1. Synthetic peptide located within the following region: LVLGTLEEVPTAGSTDPPQSPQGASAFPTTINFTRQRQPSEGSSSREEEG |
Rabbit Polyclonal Anti-MAGEA1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAGEA1 antibody: synthetic peptide directed towards the C terminal of human MAGEA1. Synthetic peptide located within the following region: MIAMEGGHAPEEEIWEELSVMEVYDGREHSAYGEPRKLLTQDLVQEKYLE |
MAGE-1/MAGE1A Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-309 of human MAGE-1/MAGE1A (NP_004979.3). |
| Modifications | Unmodified |
Active filters
Target Symbol
- MAGEA1