MAGE 1 (MAGEA1) Rabbit Polyclonal Antibody

CAT#: TA339276

Rabbit Polyclonal Anti-MAGEA1 Antibody

Product Images

WB Suggested Anti-MAGEA1 Antibody Titration: 5.0 ug/ml; Positive Control: Transfected 293T

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MAGEA1 antibody: synthetic peptide directed towards the C terminal of human MAGEA1. Synthetic peptide located within the following region: MIAMEGGHAPEEEIWEELSVMEVYDGREHSAYGEPRKLLTQDLVQEKYLE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 34 kDa
• Gene Name: MAGE family member A1
• Database Link:
  NP_004979
  Entrez Gene 4100 Human
  UniProt ID P43355
• Background: This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. [provided by RefSeq, Jul 2008]
• Synonyms: CT1.1; MAGE1
• Note: Immunogen Sequence Homology: Horse: 100%; Human: 100%; Rabbit: 86%; Rat: 83%; Dog: 79%; Pig: 79%; Bovine: 79%; Mouse: 77%