MAGE 1 (MAGEA1) Rabbit Polyclonal Antibody

CAT#: TA339276

Rabbit Polyclonal Anti-MAGEA1 Antibody


USD 310.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "MAGEA1"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-MAGEA1 antibody: synthetic peptide directed towards the C terminal of human MAGEA1. Synthetic peptide located within the following region: MIAMEGGHAPEEEIWEELSVMEVYDGREHSAYGEPRKLLTQDLVQEKYLE
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 34 kDa
Gene Name MAGE family member A1
Background This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. [provided by RefSeq, Jul 2008]
Synonyms CT1.1; MAGE1
Note Immunogen Sequence Homology: Horse: 100%; Human: 100%; Rabbit: 86%; Rat: 83%; Dog: 79%; Pig: 79%; Bovine: 79%; Mouse: 77%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.