Rabbit Polyclonal Anti-MYBL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MYBL1 antibody: synthetic peptide directed towards the middle region of human MYBL1. Synthetic peptide located within the following region: HVRIHTGEKPYHCDPCGLHFRHKSQLRLHLRQKHGAATNTKVHYHILGGP |
Rabbit polyclonal anti-MYB-A antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MYB-A. |
Rabbit Polyclonal Anti-MYBL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MYBL1 antibody: synthetic peptide directed towards the middle region of human MYBL1. Synthetic peptide located within the following region: AFIQQPFIDEDPDKEKKIKELEMLLMSAENEVRRKRIPSQPGSFSSWSGS |
Rabbit Polyclonal Anti-MYBL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MYBL1 antibody: synthetic peptide directed towards the C terminal of human MYBL1. Synthetic peptide located within the following region: RCNLIPEKQDINSTNKTYTLTKKKPNPNTSKVVKLEKNLQSNCEWETVVY |
Rabbit Polyclonal Anti-MYBL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MYBL1 antibody: synthetic peptide directed towards the middle region of human MYBL1. Synthetic peptide located within the following region: DMQSENRFTTSLLMIPLLEIHDNRCNLIPEKQDINSTNKTYTLTKKKPNP |
MYBL1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 443-692 of human MYBL1 (NP_001138227.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
