v Myb (MYBL1) Rabbit Polyclonal Antibody

CAT#: TA339671

Rabbit Polyclonal Anti-MYBL1 Antibody

Product Images

WB Suggested Anti-MYBL1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 12500; Positive Control: Human Muscle

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MYBL1 antibody: synthetic peptide directed towards the middle region of human MYBL1. Synthetic peptide located within the following region: DMQSENRFTTSLLMIPLLEIHDNRCNLIPEKQDINSTNKTYTLTKKKPNP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 86 kDa
• Gene Name: MYB proto-oncogene like 1
• Database Link:
  NP_001073885
  Entrez Gene 4603 Human
  UniProt ID P10243
• Background: MYBL1 is strong transcriptional activator; DNA-binding protein that specifically recognize the sequence 5'-YAAC[GT]G-3'. It could have a role in the proliferation and/or differentiation of neurogenic, spermatogenic and B-lymphoid cells.
• Synonyms: A-MYB; AMYB
• Note: Immunogen Sequence Homology: Horse: 100%; Human: 100%; Bovine: 100%; Pig: 93%; Rat: 93%; Mouse: 93%; Rabbit: 93%; Guinea pig: 93%; Dog: 86%