v Myb (MYBL1) Rabbit Polyclonal Antibody

CAT#: TA330038

Rabbit Polyclonal Anti-MYBL1 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "MYBL1"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-MYBL1 antibody: synthetic peptide directed towards the C terminal of human MYBL1. Synthetic peptide located within the following region: RCNLIPEKQDINSTNKTYTLTKKKPNPNTSKVVKLEKNLQSNCEWETVVY
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 86 kDa
Gene Name MYB proto-oncogene like 1
Background MYBL1 is strong transcriptional activator; DNA-binding protein that specifically recognize the sequence 5'-YAAC[GT]G-3'. It could have a role in the proliferation and/or differentiation of neurogenic, spermatogenic and B-lymphoid cells.
Synonyms A-MYB; AMYB
Note Immunogen sequence homology: Guinea pig: 100%; Human: 100%; Bovine: 92%; Horse: 92%; Rabbit: 92%; Rat: 92%; Dog: 85%; Mouse: 83%
Reference Data

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.