Rabbit Polyclonal Anti-MAGEA10 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAGEA10 antibody: synthetic peptide directed towards the middle region of human MAGEA10. Synthetic peptide located within the following region: NMMGLYDGMEHLIYGEPRKLLTQDWVQENYLEYRQVPGSDPARYEFLWGP |
Rabbit Polyclonal Anti-MAGEA10 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAGEA10 antibody: synthetic peptide directed towards the middle region of human MAGEA10. Synthetic peptide located within the following region: GSDPRSFPLWYEEALKDEEERAQDRIATTDDTTAMASASSSATGSFSYPE |
Rabbit Polyclonal Anti-MAGEA10 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human MAGEA10 |
MAGEA10 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human MAGEA10 |
MAGEA10 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human MAGEA10 |
Germany
Japan
United Kingdom
China