Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal anti-MBL2 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MBL2. |
Rabbit Polyclonal Anti-MBL2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MBL2 antibody: synthetic peptide directed towards the middle region of human MBL2. Synthetic peptide located within the following region: KEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKN |
USD 465.00
In Stock
USD 465.00
In Stock
Carrier-free (glycerol/BSA-free) MBL2 mouse monoclonal antibody, clone OTI2G5 (formerly 2G5)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
MBL2 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human MBL2 |
MBL2 Antibody - middlel region
| Applications | WB |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse MBL2 |
USD 379.00
In Stock
USD 159.00
2 Days
USD 379.00
In Stock
MBL2 mouse monoclonal antibody, clone OTI2G5 (formerly 2G5)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
MBL2 mouse monoclonal antibody, clone OTI2G5 (formerly 2G5), Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 420.00
4 Weeks
MBL2 mouse monoclonal antibody, clone OTI2G5 (formerly 2G5), HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
USD 159.00
2 Days
MBL2 mouse monoclonal antibody, clone OTI2G5 (formerly 2G5)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- MBL2