Germany
Japan
United Kingdom
China
MLLT3 / AF9 Rabbit Polyclonal (aa486-502) Antibody
| Applications | IHC |
| Reactivities | Human |
| Immunogen | MLLT3 / AF9 antibody was raised against synthetic peptide from human MLLT3. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-MLLT3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MLLT3 antibody: synthetic peptide directed towards the N terminal of human MLLT3. Synthetic peptide located within the following region: MASSCAVQVKLELGHRAQVRKKPTVEGFTHDWMVFVRGPEHSNIQHFVEK |
MLLT3 rabbit polyclonal antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human MLLT3 |
MLLT3 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human MLLT3 |
MLLT3/AF9 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human MLLT3/AF9 (NP_004520.2). |
| Modifications | Unmodified |
MLLT3/AF9 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human MLLT3/AF9 (NP_004520.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- MLLT3