Germany
Japan
United Kingdom
China
Rabbit Polyclonal Anti-MOL1A Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MOL1A Antibody: A synthesized peptide derived from human MOL1A |
Antibodies
View as table Download
Rabbit polyclonal anti-MOL1A antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MOL1A. |
Rabbit polyclonal MOB4A Antibody (C-term)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This MOB4A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 177-206 amino acids from the C-terminal region of human MOB4A. |
Rabbit Polyclonal Anti-MOB1B Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human MOB1B |
Rabbit Polyclonal Anti-MOB1B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MOB1B antibody is: synthetic peptide directed towards the C-terminal region of Human MOB1B. Synthetic peptide located within the following region: PVMSAGPKYEYHWADGTNIKKPIKCSAPKYIDYLMTWVQDQLDDETLFPS |
MOB1B rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human MOB1B |
MOB1B rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Active filters
Target Symbol
- MOB1B