Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-MRGPRX3 Antibody (Extracellular Domain)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | MRGPRX3 / MRGX3 antibody was raised against synthetic 17 amino acid peptide from 1st extracellular domain of human MRGPRX3 / MRGX3. Percent identity with other species by BLAST analysis: Human (100%); Gorilla (94%); Monkey (82%). |
Rabbit Polyclonal Anti-MRGPRX3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MRGPRX3 antibody: synthetic peptide directed towards the C terminal of human MRGPRX3. Synthetic peptide located within the following region: FLSALNSSANPIIYFFVGSFRQRQNRQNLKLVLQRALQDTPEVDEGGGWL |
Rabbit Polyclonal Anti-MRGPRX3 Antibody (Extracellular Domain)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | MRGPRX3 / MRGX3 antibody was raised against synthetic 16 amino acid peptide from 3rd extracellular domain of human MRGPRX3 / MRGX3. Percent identity with other species by BLAST analysis: Human, Monkey (100%); Gorilla (94%). |
Rabbit Polyclonal Anti-MRGPRX3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MRGPRX3 antibody: synthetic peptide directed towards the C terminal of human MRGPRX3. Synthetic peptide located within the following region: LDWKVLFCHVHLVSIFLSALNSSANPIIYFFVGSFRQRQNRQNLKLVLQR |
Active filters
Target Symbol
- MRGPRX3