Rabbit Polyclonal Anti-MYEF2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MYEF2 antibody: synthetic peptide directed towards the middle region of human MYEF2. Synthetic peptide located within the following region: QAGRLGSTIFVANLDFKVGWKKLKEVFSIAGTVKRADIKEDKDGKSRGMG |
Rabbit Polyclonal Anti-MYEF2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MYEF2 antibody: synthetic peptide directed towards the N terminal of human MYEF2. Synthetic peptide located within the following region: PAEAEKQQPQHSSSSNGVKMENDESAKEEKSDLKEKSTGSKKANRFHPYS |
MYEF2 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human MYEF2 |
MYEF2 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human MYEF2 (NP_001288139.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
