Rabbit Polyclonal Anti-MYLIP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MYLIP antibody: synthetic peptide directed towards the middle region of human MYLIP. Synthetic peptide located within the following region: CSSCEGLSCQQTRVLQEKLRKLKEAMLCMVCCEEEINSTFCPCGHTVCCE |
Carrier-free (BSA/glycerol-free) MYLIP mouse monoclonal antibody,clone OTI3A2
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
MYLIP rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human MYLIP |
MYLIP Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 266-445 of human MYLIP (NP_037394.2). |
| Modifications | Unmodified |
MYLIP mouse monoclonal antibody,clone OTI3A2
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
MYLIP mouse monoclonal antibody,clone OTI3A2, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
MYLIP mouse monoclonal antibody,clone OTI3A2, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
MYLIP mouse monoclonal antibody,clone OTI3A2
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
