MYSM1 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, WB |
Reactivities | Human, Mouse |
Immunogen | Synthetic peptide - KLH conjugated - corresponding to the N-terminal region (between 118-147aa) of human MYSM1 |
MYSM1 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, WB |
Reactivities | Human, Mouse |
Immunogen | Synthetic peptide - KLH conjugated - corresponding to the N-terminal region (between 118-147aa) of human MYSM1 |
Rabbit Polyclonal Anti-MYSM1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MYSM1 antibody is: synthetic peptide directed towards the C-terminal region of Human MYSM1. Synthetic peptide located within the following region: CLQKLLECMRKTLSKVTNCFMAEEFLTEIENLFLSNYKSNQENGVTEENC |
Rabbit Polyclonal Anti-MYSM1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MYSM1 antibody is: synthetic peptide directed towards the N-terminal region of Human MYSM1. Synthetic peptide located within the following region: KLIGSRTVLQVKSYARQYFKNKVKCGLDKETPNQKTGHNLQVKNEDKGTK |
Anti-MYSM1 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 808-821 amino acids of Human Myb-like, SWIRM and MPN domains 1 |
Anti-MYSM1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 808-821 amino acids of Human Myb-like, SWIRM and MPN domains 1 |
MYSM1 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 700 to the C-terminus of human MYSM1 (NP_001078956.1). |
Modifications | Unmodified |