NCF4 (228-238) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Equine, Human, Monkey |
Immunogen | Synthetic peptide from an internal region of human NCF4 |
NCF4 (228-238) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Equine, Human, Monkey |
Immunogen | Synthetic peptide from an internal region of human NCF4 |
Anti-NCF4 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to N terminal 190 amino acids of human neutrophil cytosolic factor 4, 40kDa |
Goat Polyclonal Antibody against NCF4 / P40PHOX
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-KDFPEEDDPTN, from the internal region of the protein sequence according to NP_000622.2; NP_038202.1. |
Rabbit Polyclonal Anti-NCF4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NCF4 antibody: synthetic peptide directed towards the N terminal of human NCF4. Synthetic peptide located within the following region: SKYLIYRRYRQFHALQSKLEERFGPDSKSSALACTLPTLPAKVYVGVKQE |
Rabbit Polyclonal Anti-NCF4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NCF4 antibody: synthetic peptide directed towards the middle region of human NCF4. Synthetic peptide located within the following region: TGIFPLSFVKILKDFPEEDDPTNWLRCYYYEDTISTIKSVAWEGGACPAF |
Carrier-free (BSA/glycerol-free) NCF4 mouse monoclonal antibody, clone OTI4B5 (formerly 4B5)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NCF4 mouse monoclonal antibody,clone OTI12H10
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NCF4 mouse monoclonal antibody,clone OTI3E3
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NCF4 mouse monoclonal antibody,clone OTI1A7
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NCF4 mouse monoclonal antibody,clone OTI4E5
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NCF4 mouse monoclonal antibody,clone OTI2D4
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NCF4 mouse monoclonal antibody,clone OTI3E8
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NCF4 mouse monoclonal antibody,clone OTI6H9
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Phospho-NCF4/p40-phox-T154 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A synthetic phosphorylated peptide around T154 of human NCF4. |
Modifications | Unmodified |
NCF4 mouse monoclonal antibody, clone OTI4B5 (formerly 4B5)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
NCF4 mouse monoclonal antibody, clone OTI4B5 (formerly 4B5), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
NCF4 mouse monoclonal antibody, clone OTI4B5 (formerly 4B5), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
NCF4 mouse monoclonal antibody, clone OTI4B5 (formerly 4B5)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
NCF4 mouse monoclonal antibody,clone OTI12H10
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
NCF4 mouse monoclonal antibody,clone OTI12H10, Biotinylated
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
NCF4 mouse monoclonal antibody,clone OTI12H10, HRP conjugated
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
NCF4 mouse monoclonal antibody,clone OTI12H10
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
NCF4 mouse monoclonal antibody,clone OTI3E3
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
NCF4 mouse monoclonal antibody,clone OTI3E3, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
NCF4 mouse monoclonal antibody,clone OTI3E3, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
NCF4 mouse monoclonal antibody,clone OTI3E3
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
NCF4 mouse monoclonal antibody,clone OTI1A7
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
NCF4 mouse monoclonal antibody,clone OTI1A7, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
NCF4 mouse monoclonal antibody,clone OTI1A7, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
NCF4 mouse monoclonal antibody,clone OTI1A7
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
NCF4 mouse monoclonal antibody,clone OTI4E5
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
NCF4 mouse monoclonal antibody,clone OTI4E5, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
NCF4 mouse monoclonal antibody,clone OTI4E5, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
NCF4 mouse monoclonal antibody,clone OTI4E5
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
NCF4 mouse monoclonal antibody,clone OTI2D4
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
NCF4 mouse monoclonal antibody,clone OTI2D4, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
NCF4 mouse monoclonal antibody,clone OTI2D4, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
NCF4 mouse monoclonal antibody,clone OTI2D4
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
NCF4 mouse monoclonal antibody,clone OTI3E8
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
NCF4 mouse monoclonal antibody,clone OTI3E8, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
NCF4 mouse monoclonal antibody,clone OTI3E8, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
NCF4 mouse monoclonal antibody,clone OTI3E8
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
NCF4 mouse monoclonal antibody,clone OTI6H9
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
NCF4 mouse monoclonal antibody,clone OTI6H9, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
NCF4 mouse monoclonal antibody,clone OTI6H9, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
NCF4 mouse monoclonal antibody,clone OTI6H9
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |