Antibodies

Jump to Filters
View as table Download
NETO1 Rabbit Polyclonal Antibody
TA320034

USD 430.00

5 Days

Rabbit Polyclonal NETO1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen NETO1 antibody was raised against an 18 amino acid synthetic peptide near the carboxy terminus of human NETO1.
NETO1 Rabbit Polyclonal Antibody
TA342747

USD 375.00

5 Days

Rabbit Polyclonal Anti-NETO1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-NETO1 antibody: synthetic peptide directed towards the C terminal of human NETO1. Synthetic peptide located within the following region: MCINNTLVCNGLQNCVYPWDENHCKEKRKTSLLDQLTNTSGTVIGVTSCI