Rabbit polyclonal NFIA Antibody (C-term)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This NFIA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 470-498 amino acids from the C-terminal region of human NFIA. |
Rabbit polyclonal Nuclear Factor 1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Nuclear Factor 1. |
Rabbit Polyclonal Anti-Nfia Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Nfia antibody is: synthetic peptide directed towards the middle region of Mouse Nfia. Synthetic peptide located within the following region: YLAYFVHAADSSQSESPSQPSEADIKDQPENGHLGFQDSFVTSGVFSVTE |
Rabbit Polyclonal Anti-NFIA Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NFIA antibody: synthetic peptide directed towards the middle region of human NFIA. Synthetic peptide located within the following region: QHHRPVITGPRASPHATPSTLHFPTSPIIQQPGPYFSHPAIRYHPQETLK |
Rabbit Polyclonal Anti-Nfia Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Nfia antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: PMPDTKPPTTSTEGGAASPTSPTYSTPSTSPANRFVSVGPRDPSFVNIPQ |
Carrier-free (BSA/glycerol-free) NFIA mouse monoclonal antibody,clone OTI4G7
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NFIA mouse monoclonal antibody,clone OTI5C4
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NFIA mouse monoclonal antibody,clone OTI4G8
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NFIA mouse monoclonal antibody,clone OTI6F1
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
NFIA Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 180-330 of human NFIA (NP_005586.1). |
| Modifications | Unmodified |
NFIA mouse monoclonal antibody,clone OTI4G7
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
NFIA mouse monoclonal antibody,clone OTI4G7, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
NFIA mouse monoclonal antibody,clone OTI4G7, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
NFIA mouse monoclonal antibody,clone OTI4G7
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
NFIA mouse monoclonal antibody,clone OTI5C4
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
NFIA mouse monoclonal antibody,clone OTI5C4, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
NFIA mouse monoclonal antibody,clone OTI5C4, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
NFIA mouse monoclonal antibody,clone OTI5C4
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
NFIA mouse monoclonal antibody,clone OTI4G8
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
NFIA mouse monoclonal antibody,clone OTI4G8, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
NFIA mouse monoclonal antibody,clone OTI4G8, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
NFIA mouse monoclonal antibody,clone OTI4G8
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
NFIA mouse monoclonal antibody,clone OTI6F1
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
NFIA mouse monoclonal antibody,clone OTI6F1, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
USD 420.00
4 Weeks
NFIA mouse monoclonal antibody,clone OTI6F1, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
NFIA mouse monoclonal antibody,clone OTI6F1
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
