Rabbit Polyclonal Anti-MKI67IP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MKI67IP antibody: synthetic peptide directed towards the middle region of human MKI67IP. Synthetic peptide located within the following region: QPSYQSVKRYNRNRTLTQKLRMEERFKKKERLLRKKLAKKGIDYDFPSLI |
NIFK rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC |
| Reactivities | Human, Mouse |
Rabbit polyclonal NIFK(Thr234) antibody(Phospho-specific)
| Applications | IF, IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human NIFK around the phosphorylation site of threonine 234 (G-P-TP-P-V). |
| Modifications | Phospho-specific |
Mouse Monoclonal NIFK Antibody (18E148)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
NIFK rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human NIFK |
Germany
Japan
United Kingdom
China
