Germany
Japan
United Kingdom
China
NIT1 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | Synthetic peptide - KLH conjugated - corresponding to the C-terminal region (between 297-327aa) of human NIT1 |
Antibodies
View as table Download
Rabbit polyclonal Anti-NIT1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NIT1 antibody: synthetic peptide directed towards the N terminal of human NIT1. Synthetic peptide located within the following region: VREAARLGACLAFLPEAFDFIARDPAETLHLSEPLGGKLLEEYTQLAREC |
Rabbit polyclonal Anti-NIT1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NIT1 antibody: synthetic peptide directed towards the N terminal of human NIT1. Synthetic peptide located within the following region: VREAARLGACLAFLPEAFDFIARDPAETLHLSEPLGGKLLEEYTQLAREC |
Rabbit Polyclonal Anti-NIT1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human NIT1 |
NIT1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human NIT1 |
NIT1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human NIT1 |
NIT1 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human NIT1 |
NIT1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human NIT1 (NP_001172021.1). |
| Modifications | Unmodified |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Active filters
Target Symbol
- NIT1