Rabbit Polyclonal Anti-NKX2-3 Antibody
| Applications | IHC, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Nkx2-3 antibody: synthetic peptide directed towards the c terminal of mouse Nkx2-3. Synthetic peptide located within the following region: AAAYSGSYGCAYPTGGGGGGGGTASAATTAMQPACSATGGGSFVNVSNLG |
Rabbit Polyclonal Anti-NKX2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NKX2-3 antibody: synthetic peptide directed towards the middle region of human NKX2-3. Synthetic peptide located within the following region: AHAPPPPPRRVAVPVLVRDGKPCVTPSAQAYGAPYSVGASAYSYNSFPAY |
Rabbit Polyclonal Anti-NKX2
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-NKX2-3 Antibody: synthetic peptide directed towards the N terminal of human NKX2-3. Synthetic peptide located within the following region: ADLEHHFHSAPCMLAAAEGTQFSDGGEEDEEDEGEKLSYLNSLAAADGHG |
Rabbit Polyclonal Anti-NKX2-3 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NKX2-3 antibody: synthetic peptide directed towards the middle region of mouse NKX2-3. Synthetic peptide located within the following region: GTHAPPPPPRRVAVPVLVRDGKPCVTPSAQTYGSPYGVGAGAYSYNSFPA |
Germany
Japan
United Kingdom
China
