Rabbit Polyclonal Anti-NMI Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NMI antibody: synthetic peptide directed towards the middle region of human NMI. Synthetic peptide located within the following region: SFSKSRNGGGEVDRVDYDRQSGSAVITFVEIGVADKILKKKEYPLYINQT |
Rabbit Polyclonal Anti-NMI Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NMI antibody: synthetic peptide directed towards the N terminal of human NMI. Synthetic peptide located within the following region: ETKMKFLSVETPENDSQLSNISCSFQVSSKVPYEIQKGQALITFEKEEVA |
Carrier-free (BSA/glycerol-free) NMI mouse monoclonal antibody,clone OTI1A8
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NMI mouse monoclonal antibody,clone OTI3C6
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NMI mouse monoclonal antibody,clone OTI1C5
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
NMI Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-307 of human NMI (NP_004679.2). |
| Modifications | Unmodified |
NMI mouse monoclonal antibody,clone OTI2C1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: "KO15".
USD 420.00
4 Weeks
USD 420.00
4 Weeks
NMI mouse monoclonal antibody,clone OTI1A8
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
NMI mouse monoclonal antibody,clone OTI1A8, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 420.00
4 Weeks
NMI mouse monoclonal antibody,clone OTI1A8, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
NMI mouse monoclonal antibody,clone OTI1A8
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
NMI mouse monoclonal antibody,clone OTI3C6
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
NMI mouse monoclonal antibody,clone OTI3C6, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 420.00
4 Weeks
NMI mouse monoclonal antibody,clone OTI3C6, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
NMI mouse monoclonal antibody,clone OTI3C6
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
NMI mouse monoclonal antibody,clone OTI1C5
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
NMI mouse monoclonal antibody,clone OTI1C5, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
USD 420.00
4 Weeks
NMI mouse monoclonal antibody,clone OTI1C5, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
NMI mouse monoclonal antibody,clone OTI1C5
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
