Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-NUSAP1 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human NUSAP1. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-NUSAP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NUSAP1 antibody: synthetic peptide directed towards the C terminal of human NUSAP1. Synthetic peptide located within the following region: LKASLSRPLNYEPHKGKLKPWGQSKENNYLNQHVNRINFYKKTYKQPHLQ |
Rabbit Polyclonal Anti-NUSAP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NUSAP1 antibody: synthetic peptide directed towards the middle region of human NUSAP1. Synthetic peptide located within the following region: AENAVSSGNRDSKVPSEGKKSLYTDESSKPGKNKRTAITTPNFKKLHEAH |
Rabbit Polyclonal Anti-NUSAP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human NUSAP1 |
NUSAP1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human NUSAP |
NUSAP1 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human NUSAP1 |
Active filters
Target Symbol
- NUSAP1