Antibodies

Jump to Filters
View as table Download
OTOP1 (Center) Rabbit Polyclonal Antibody
AP53128PU-N

USD 450.00

2 Weeks

OTOP1 (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 367-396 amino acids from the Central region of Human Otopetrin-1
OTOP1 Rabbit Polyclonal Antibody
TA337748

USD 375.00

5 Days

Rabbit Polyclonal Anti-OTOP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-OTOP1 antibody is: synthetic peptide directed towards the C-terminal region of Human OTOP1. Synthetic peptide located within the following region: KTKSESALIMFYLYAITLLMLMGAAGLAGIRIYRIDEKSLDESKNPARKL