OTOP1 Rabbit Polyclonal Antibody

CAT#: TA337748

Rabbit Polyclonal Anti-OTOP1 Antibody

Product Images

WB Suggested Anti-OTOP1 Antibody; Titration: 1.0 ug/ml; Positive Control: Fetal Lung

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-OTOP1 antibody is: synthetic peptide directed towards the C-terminal region of Human OTOP1. Synthetic peptide located within the following region: KTKSESALIMFYLYAITLLMLMGAAGLAGIRIYRIDEKSLDESKNPARKL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 67 kDa
• Gene Name: otopetrin 1
• Database Link:
  NP_819056
  Entrez Gene 133060 Human
  UniProt ID Q7RTM1
• Background: OTOP1 is required for normal formation of otoconia in the inner ear. OTOP1 inhibits P2Y purinoceptors and modulates calcium homeostasis and influx of calcium in response to extracellular ATP.
• Synonyms: MGC163302; MGC163304
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Bovine: 93%; Rabbit: 93%; Dog: 86%

Reference Data

• Protein Families: Transmembrane