Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-PEG10
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PEG10 antibody is: synthetic peptide directed towards the C-terminal region of Human PEG10. Synthetic peptide located within the following region: RKPRSPPRALVLPHIASHHQVDPTEPVGGARMRLTQEEKERRRKLNLCLY |
Rabbit Polyclonal Anti-PEG10
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PEG10 antibody is: synthetic peptide directed towards the N-terminal region of Human PEG10. Synthetic peptide located within the following region: SMMTGRAARWASAKLERSHYLMHNYPAFMMEMKHVFEDPQRREVAKRKIR |
Carrier-free (BSA/glycerol-free) PEG10 mouse monoclonal antibody,clone OTI1G10
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Anti-PEG10 Rabbit Polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human paternally expressed 10 |
PEG10 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-325 of human PEG10 (NP_001035242.1). |
| Modifications | Unmodified |
PEG10 mouse monoclonal antibody,clone OTI1G10
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
PEG10 mouse monoclonal antibody,clone OTI1G10, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
PEG10 mouse monoclonal antibody,clone OTI1G10, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
PEG10 mouse monoclonal antibody,clone OTI1G10
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- PEG10