Rabbit Polyclonal Anti-Pou3f3 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Pou3f3 antibody is: synthetic peptide directed towards the C-terminal region of Rat Pou3f3. Synthetic peptide located within the following region: VVRVWFCNRRQKEKRMTPPGIQQQTPDDVYSQVGTVSADTPPPHHGLQTS |
Goat Anti-POU3F3 / BRN1 / OCT8 Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-HMLSHAHQWVTAL, from the internal region of the protein sequence according to NP_006227.1. |
Rabbit Polyclonal Anti-POU3F3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-POU3F3 Antibody: synthetic peptide directed towards the N terminal of human POU3F3. Synthetic peptide located within the following region: GGGGGGGGGAGGGGGGMQPGSAAVTSGAYRGDPSSVKMVQSDFMQGAMAA |
Germany
Japan
United Kingdom
China
