POU3F3 Rabbit Polyclonal Antibody

CAT#: TA344555

Rabbit Polyclonal Anti-Pou3f3 Antibody - C-terminal region

Product Images

Host: Rabbit; Target Name: Pou3f3; Sample Tissue: Rat Testis lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Pou3f3 antibody is: synthetic peptide directed towards the C-terminal region of Rat Pou3f3. Synthetic peptide located within the following region: VVRVWFCNRRQKEKRMTPPGIQQQTPDDVYSQVGTVSADTPPPHHGLQTS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 54 kDa
• Gene Name: POU class 3 homeobox 3
• Database Link:
  NP_006227
  Entrez Gene 192109 RatEntrez Gene 5455 Human
  UniProt ID P20264
• Background: Pou3f3 acts as a transcriptional activator in oligodendrocytes; Pou3f3 may play a role in regulation of neural development
• Synonyms: brain-1; BRN1; oct-8; OTF8
• Note: Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Dog: 92%

Reference Data

• Protein Families: Transcription Factors