POU3F3 Rabbit Polyclonal Antibody

CAT#: TA332043

Rabbit Polyclonal Anti-POU3F3 Antibody

Product Images

Host: Rabbit; Target Name: POU3F3; Sample Tissue: Human Fetal Liver; Antibody Dilution: 1.0ug/ml

• 

  Host: Rabbit; Target Name: POU3F3; Sample Tissue: Human Fetal Lung; Antibody Dilution: 1.0ug/ml

• 

  WB Suggested Anti-POU3F3 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: OVCAR-3 cell lysatePOU3F3 is supported by BioGPS gene expression data to be expressed in OVCAR3

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-POU3F3 Antibody: synthetic peptide directed towards the N terminal of human POU3F3. Synthetic peptide located within the following region: GGGGGGGGGAGGGGGGMQPGSAAVTSGAYRGDPSSVKMVQSDFMQGAMAA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 50 kDa
• Gene Name: POU class 3 homeobox 3
• Database Link:
  NP_006227
  Entrez Gene 5455 Human
  UniProt ID P20264
• Background: POU3F3 is the transcription factor that acts synergistically with SOX11 and SOX4. POU3F3 plays a role in neuronal development. POU3F3 is implicated in an enhancer activity at the embryonic met-mesencephalic junction; the enhancer element contains the octamer motif (5'-ATTTGCAT-3').POU3F3 is a member of the class III POU family of transcription factors (see POU3F1; MIM 602479) that are expressed in the central nervous system. The POU domain in these proteins is required for high affinity binding to octamer DNA sequences Sumiyama et al. (1996) [PubMed 8703082]. [supplied by OMIM]
• Synonyms: brain-1; BRN1; oct-8; OTF8
• Note: Immunogen sequence homology: Rat: 100%; Human: 100%; Mouse: 100%

Reference Data

• Protein Families: Transcription Factors