Germany
Japan
United Kingdom
China
Rabbit Polyclonal PRCC Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Monkey, Mouse |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-PRCC Antibody - C-terminal region
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Prcc antibody is: synthetic peptide directed towards the C-terminal region of Rat Prcc. Synthetic peptide located within the following region: KKKGEQPTGQQRRKHQITYLIHQAKERELELKNTWSENKLSRRQTQAKYG |
USD 485.00
5 Days
Mouse Monoclonal Renal Cell Carcinoma Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 465.00
4 Weeks
USD 465.00
4 Weeks
USD 379.00
In Stock
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 159.00
2 Days
USD 379.00
In Stock
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 159.00
2 Days
Active filters
Target Symbol
- PRCC