Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 12 of 12 results

(reset)

Ptbp3 Rabbit Polyclonal Antibody

TA345914

USD 475.00

5 Days

Rabbit Polyclonal Anti-Rod1 Antibody

Applications	WB
Reactivities	Mouse
Conjugation	Unconjugated
Immunogen	The immunogen for anti-Rod1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: YYTPVTPHLRSQPVYIQYSNHRELKTDNLPNQARAQAALQAVSAVQSGNL

ROD1 (PTBP3) Mouse Monoclonal Antibody [Clone ID: OTI5G7]

CF812031

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) PTBP3 mouse monoclonal antibody,clone OTI5G7

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

ROD1 (PTBP3) Mouse Monoclonal Antibody [Clone ID: OTI5C9]

CF812036

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) PTBP3 mouse monoclonal antibody,clone OTI5C9

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

ROD1 (PTBP3) Rabbit Polyclonal Antibody

TA360313

USD 360.00

5 Days

PTBP3 Antibody - N-terminal region

Applications	WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen is a synthetic peptide directed towards the N terminal region of human ROD1

ROD1 (PTBP3) Mouse Monoclonal Antibody [Clone ID: OTI5G7]

TA812031

USD 379.00

In Stock

PTBP3 mouse monoclonal antibody,clone OTI5G7

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

ROD1 (PTBP3) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5G7]

TA812031AM

USD 420.00

4 Weeks

PTBP3 mouse monoclonal antibody,clone OTI5G7, Biotinylated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

ROD1 (PTBP3) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5G7]

TA812031BM

USD 420.00

4 Weeks

PTBP3 mouse monoclonal antibody,clone OTI5G7, HRP conjugated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

ROD1 (PTBP3) Mouse Monoclonal Antibody [Clone ID: OTI5G7]

TA812031S

USD 159.00

2 Days

PTBP3 mouse monoclonal antibody,clone OTI5G7

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

ROD1 (PTBP3) Mouse Monoclonal Antibody [Clone ID: OTI5C9]

TA812036

USD 379.00

In Stock

PTBP3 mouse monoclonal antibody,clone OTI5C9

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

ROD1 (PTBP3) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5C9]

TA812036AM

USD 420.00

4 Weeks

PTBP3 mouse monoclonal antibody,clone OTI5C9, Biotinylated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

ROD1 (PTBP3) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5C9]

TA812036BM

USD 420.00

4 Weeks

PTBP3 mouse monoclonal antibody,clone OTI5C9, HRP conjugated

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

ROD1 (PTBP3) Mouse Monoclonal Antibody [Clone ID: OTI5C9]

TA812036S

USD 159.00

2 Days

PTBP3 mouse monoclonal antibody,clone OTI5C9

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

1 - 12 of 12 results