Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-PTPN22 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human PTPN22. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-PTPN22 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PTPN22 Antibody: A synthesized peptide derived from human PTPN22 |
PTPN22 mouse monoclonal antibody, clone 1A6, Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
PTPN22 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | Synthetic peptide - KLH conjugated - corresponding to the C-terminal region (between 662-691aa) of human PTPN22. |
Rabbit Polyclonal Anti-PTPN22 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PTPN22 antibody is: synthetic peptide directed towards the middle region of Human PTPN22. Synthetic peptide located within the following region: TAPRIDDEIPPPLPVWTPESFIVVEEAGEFSPNVPKSLSSAVKVKIGTSL |
PTPN22 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human PTPN22 (NP_036543.4). |
| Modifications | Unmodified |
USD 420.00
2 Weeks
Active filters
Target Symbol
- PTPN22