Mouse Monoclonal PEG10 Antibody
Applications | IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Mouse Monoclonal PEG10 Antibody
Applications | IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
PEG10 mouse monoclonal antibody, clone 1B1C4, Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
PEG10 mouse monoclonal antibody, clone 4C10A7, Ascites
Applications | ELISA, IHC, WB |
Reactivities | Human |
PEG10 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human PEG10 |
Rabbit Polyclonal Anti-PEG10
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-PEG10 antibody is: synthetic peptide directed towards the C-terminal region of Human PEG10. Synthetic peptide located within the following region: RKPRSPPRALVLPHIASHHQVDPTEPVGGARMRLTQEEKERRRKLNLCLY |
Rabbit Polyclonal Anti-PEG10
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-PEG10 antibody is: synthetic peptide directed towards the N-terminal region of Human PEG10. Synthetic peptide located within the following region: SMMTGRAARWASAKLERSHYLMHNYPAFMMEMKHVFEDPQRREVAKRKIR |
Carrier-free (BSA/glycerol-free) PEG10 mouse monoclonal antibody,clone OTI1G10
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Anti-PEG10 Rabbit Polyclonal Antibody
Applications | ELISA, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human paternally expressed 10 |
PEG10 Rabbit polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-325 of human PEG10 (NP_001035242.1). |
Modifications | Unmodified |
PEG10 mouse monoclonal antibody,clone OTI1G10
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
PEG10 mouse monoclonal antibody,clone OTI1G10, Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
PEG10 mouse monoclonal antibody,clone OTI1G10, HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
PEG10 mouse monoclonal antibody,clone OTI1G10
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".