Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-PHLA1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PHLA1. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-PHLDA1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PHLDA1 antibody: synthetic peptide directed towards the middle region of human PHLDA1. Synthetic peptide located within the following region: PAVASLEPPVKLKELHFSNMKTVDCVERKGKYMYFTVVMAEGKEIDFRCP |
Rabbit Polyclonal Anti-PHLDA1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PHLDA1 antibody: synthetic peptide directed towards the C terminal of human PHLDA1. Synthetic peptide located within the following region: LAVKSTRQKQQHLVQQQPPSQPQPQPQLQPQPQPQPQPQPQPQSQPQPQP |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Active filters
Target Symbol
- PHLDA1