Antibodies

Jump to Filters
View as table Download
E3 SUMO protein ligase PIAS4 (PIAS4) Rabbit Polyclonal Antibody
TA347977

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-PIAS4 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PIAS4 Antibody: A synthesized peptide derived from human PIAS4
E3 SUMO protein ligase PIAS4 (PIAS4) Rabbit Polyclonal Antibody
TA311668

USD 345.00

4 Weeks

Rabbit polyclonal anti-PIAS4 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human PIAS4.
E3 SUMO protein ligase PIAS4 (PIAS4) Rabbit Polyclonal Antibody
TA319932

USD 430.00

5 Days

Rabbit Polyclonal PIAS4 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen PIAS4 antibody was raised against a 19 amino acid synthetic peptide near the amino terminus of human PIAS4.
E3 SUMO protein ligase PIAS4 (PIAS4) Rabbit Polyclonal Antibody
TA331936

USD 375.00

5 Days

Rabbit Polyclonal Anti-PIAS4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PIAS4 Antibody: synthetic peptide directed towards the N terminal of human PIAS4. Synthetic peptide located within the following region: AKNMVMSFRVSDLQMLLGFVGRSKSGLKHELVTRALQLVQFDCSPELFKK
E3 SUMO protein ligase PIAS4 (PIAS4) Rabbit Polyclonal Antibody
TA379910

USD 220.00

3 Weeks

PIAS4 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 60-260 of human PIAS4 (NP_056981.2).
Modifications Unmodified