PIH1D2 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Immunogen | Synthetic peptide - KLH conjugated - corresponding to the C-terminal region (between 227-257aa) of human PIH1D2. |
PIH1D2 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Immunogen | Synthetic peptide - KLH conjugated - corresponding to the C-terminal region (between 227-257aa) of human PIH1D2. |
Rabbit Polyclonal Anti-PIH1D2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-PIH1D2 Antibody is: synthetic peptide directed towards the N-terminal region of Human PIH1D2. Synthetic peptide located within the following region: PKEKILFINLCQWTRIPAPQSTTHPVPLTVGKPEDTTEISDAYTVIDVAY |
Rabbit Polyclonal Anti-PIH1D2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-PIH1D2 Antibody is: synthetic peptide directed towards the N-terminal region of Human PIH1D2. Synthetic peptide located within the following region: SKGLLTQVTQFWNLLDDLAQSDPEGYEKFIQQQLKEGKQLCAAPEPQLCL |
Carrier-free (BSA/glycerol-free) PIH1D2 mouse monoclonal antibody, clone OTI1A2 (formerly 1A2)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PIH1D2 mouse monoclonal antibody, clone OTI5G9 (formerly 5G9)
Applications | WB |
Reactivities | Human, Monkey |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PIH1D2 mouse monoclonal antibody, clone OTI4A10 (formerly 4A10)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PIH1D2 mouse monoclonal antibody, clone OTI5C12 (formerly 5C12)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
PIH1D2 mouse monoclonal antibody, clone OTI1A2 (formerly 1A2)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
PIH1D2 mouse monoclonal antibody, clone OTI1A2 (formerly 1A2), Biotinylated
Applications | FC, WB |
Reactivities | Human |
Conjugation | Biotin |
PIH1D2 mouse monoclonal antibody, clone OTI1A2 (formerly 1A2), HRP conjugated
Applications | FC, WB |
Reactivities | Human |
Conjugation | HRP |
PIH1D2 mouse monoclonal antibody, clone OTI1A2 (formerly 1A2)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
PIH1D2 mouse monoclonal antibody, clone OTI5G9 (formerly 5G9)
Applications | WB |
Reactivities | Human, Monkey |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
PIH1D2 mouse monoclonal antibody, clone OTI5G9 (formerly 5G9), Biotinylated
Applications | WB |
Reactivities | Human, Monkey |
Conjugation | Biotin |
PIH1D2 mouse monoclonal antibody, clone OTI5G9 (formerly 5G9), HRP conjugated
Applications | WB |
Reactivities | Human, Monkey |
Conjugation | HRP |
PIH1D2 mouse monoclonal antibody, clone OTI5G9 (formerly 5G9)
Applications | WB |
Reactivities | Human, Monkey |
Conjugation | Unconjugated |
PIH1D2 mouse monoclonal antibody, clone OTI4A10 (formerly 4A10)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
PIH1D2 mouse monoclonal antibody, clone OTI4A10 (formerly 4A10), Biotinylated
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
PIH1D2 mouse monoclonal antibody, clone OTI4A10 (formerly 4A10), HRP conjugated
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | HRP |
PIH1D2 mouse monoclonal antibody, clone OTI4A10 (formerly 4A10)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
PIH1D2 mouse monoclonal antibody, clone OTI5C12 (formerly 5C12)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
PIH1D2 mouse monoclonal antibody, clone OTI5C12 (formerly 5C12), Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
PIH1D2 mouse monoclonal antibody, clone OTI5C12 (formerly 5C12), HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
PIH1D2 mouse monoclonal antibody, clone OTI5C12 (formerly 5C12)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |