Antibodies

Jump to Filters
View as table Download
Trypsin (PRSS3) (Center) Rabbit Polyclonal Antibody
AP53469PU-N

USD 450.00

2 Weeks

Trypsin (PRSS3) (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 143-171 amino acids from the Central region of Human Trypsin-3 / PRSS3
Trypsin (PRSS3) (N-term) Rabbit Polyclonal Antibody
AP53470PU-N

USD 450.00

2 Weeks

Trypsin (PRSS3) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen Synthetic peptide - KLH conjugated - corresponding to the N-terminal region (between 20-48aa) of human Trypsin-3 / PRSS3
Trypsin (PRSS3) Rabbit Polyclonal Antibody
TA342157

USD 375.00

5 Days

Rabbit polyclonal Anti-PRSS3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PRSS3 antibody: synthetic peptide directed towards the N terminal of human PRSS3. Synthetic peptide located within the following region: VAVPFDDDDKIVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAH