Trypsin (PRSS3) (Center) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 143-171 amino acids from the Central region of Human Trypsin-3 / PRSS3 |
Trypsin (PRSS3) (Center) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 143-171 amino acids from the Central region of Human Trypsin-3 / PRSS3 |
Trypsin (PRSS3) (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Immunogen | Synthetic peptide - KLH conjugated - corresponding to the N-terminal region (between 20-48aa) of human Trypsin-3 / PRSS3 |
Rabbit polyclonal Anti-PRSS3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PRSS3 antibody: synthetic peptide directed towards the N terminal of human PRSS3. Synthetic peptide located within the following region: VAVPFDDDDKIVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAH |